cmd/compile: improve interface type switches

For type switches where the targets are interface types,
call into the runtime once instead of doing a sequence
of assert* calls.

name                                 old time/op  new time/op  delta
SwitchInterfaceTypePredictable-24    26.6ns ± 1%  25.8ns ± 2%  -2.86%  (p=0.000 n=10+10)
SwitchInterfaceTypeUnpredictable-24  39.3ns ± 1%  37.5ns ± 2%  -4.57%  (p=0.000 n=10+10)

Not super helpful by itself, but this code organization allows
followon CLs that add caching to the lookups.

Change-Id: I7967f85a99171faa6c2550690e311bea8b54b01c
Reviewed-on: https://go-review.googlesource.com/c/go/+/526657
Reviewed-by: Matthew Dempsky <mdempsky@google.com>
LUCI-TryBot-Result: Go LUCI <golang-scoped@luci-project-accounts.iam.gserviceaccount.com>
Reviewed-by: Cuong Manh Le <cuong.manhle.vn@gmail.com>
Reviewed-by: Keith Randall <khr@google.com>
This commit is contained in:
Keith Randall 2023-09-01 20:32:07 -07:00
parent 10da3b64af
commit 28f4ea16a2
14 changed files with 745 additions and 358 deletions

View File

@ -293,6 +293,7 @@ const (
OINLMARK // start of an inlined body, with file/line of caller. Xoffset is an index into the inline tree. OINLMARK // start of an inlined body, with file/line of caller. Xoffset is an index into the inline tree.
OLINKSYMOFFSET // offset within a name OLINKSYMOFFSET // offset within a name
OJUMPTABLE // A jump table structure for implementing dense expression switches OJUMPTABLE // A jump table structure for implementing dense expression switches
OINTERFACESWITCH // A type switch with interface cases
// opcodes for generics // opcodes for generics
ODYNAMICDOTTYPE // x = i.(T) where T is a type parameter (or derived from a type parameter) ODYNAMICDOTTYPE // x = i.(T) where T is a type parameter (or derived from a type parameter)

View File

@ -847,6 +847,52 @@ func (n *InlinedCallExpr) editChildrenWithHidden(edit func(Node) Node) {
editNodes(n.ReturnVars, edit) editNodes(n.ReturnVars, edit)
} }
func (n *InterfaceSwitchStmt) Format(s fmt.State, verb rune) { fmtNode(n, s, verb) }
func (n *InterfaceSwitchStmt) copy() Node {
c := *n
c.init = copyNodes(c.init)
return &c
}
func (n *InterfaceSwitchStmt) doChildren(do func(Node) bool) bool {
if doNodes(n.init, do) {
return true
}
if n.Case != nil && do(n.Case) {
return true
}
if n.Itab != nil && do(n.Itab) {
return true
}
if n.RuntimeType != nil && do(n.RuntimeType) {
return true
}
return false
}
func (n *InterfaceSwitchStmt) editChildren(edit func(Node) Node) {
editNodes(n.init, edit)
if n.Case != nil {
n.Case = edit(n.Case).(Node)
}
if n.Itab != nil {
n.Itab = edit(n.Itab).(Node)
}
if n.RuntimeType != nil {
n.RuntimeType = edit(n.RuntimeType).(Node)
}
}
func (n *InterfaceSwitchStmt) editChildrenWithHidden(edit func(Node) Node) {
editNodes(n.init, edit)
if n.Case != nil {
n.Case = edit(n.Case).(Node)
}
if n.Itab != nil {
n.Itab = edit(n.Itab).(Node)
}
if n.RuntimeType != nil {
n.RuntimeType = edit(n.RuntimeType).(Node)
}
}
func (n *JumpTableStmt) Format(s fmt.State, verb rune) { fmtNode(n, s, verb) } func (n *JumpTableStmt) Format(s fmt.State, verb rune) { fmtNode(n, s, verb) }
func (n *JumpTableStmt) copy() Node { func (n *JumpTableStmt) copy() Node {
c := *n c := *n

View File

@ -151,19 +151,20 @@ func _() {
_ = x[OINLMARK-140] _ = x[OINLMARK-140]
_ = x[OLINKSYMOFFSET-141] _ = x[OLINKSYMOFFSET-141]
_ = x[OJUMPTABLE-142] _ = x[OJUMPTABLE-142]
_ = x[ODYNAMICDOTTYPE-143] _ = x[OINTERFACESWITCH-143]
_ = x[ODYNAMICDOTTYPE2-144] _ = x[ODYNAMICDOTTYPE-144]
_ = x[ODYNAMICTYPE-145] _ = x[ODYNAMICDOTTYPE2-145]
_ = x[OTAILCALL-146] _ = x[ODYNAMICTYPE-146]
_ = x[OGETG-147] _ = x[OTAILCALL-147]
_ = x[OGETCALLERPC-148] _ = x[OGETG-148]
_ = x[OGETCALLERSP-149] _ = x[OGETCALLERPC-149]
_ = x[OEND-150] _ = x[OGETCALLERSP-150]
_ = x[OEND-151]
} }
const _Op_name = "XXXNAMENONAMETYPELITERALNILADDSUBORXORADDSTRADDRANDANDAPPENDBYTES2STRBYTES2STRTMPRUNES2STRSTR2BYTESSTR2BYTESTMPSTR2RUNESSLICE2ARRSLICE2ARRPTRASAS2AS2DOTTYPEAS2FUNCAS2MAPRAS2RECVASOPCALLCALLFUNCCALLMETHCALLINTERCAPCLEARCLOSECLOSURECOMPLITMAPLITSTRUCTLITARRAYLITSLICELITPTRLITCONVCONVIFACECONVNOPCOPYDCLDCLFUNCDELETEDOTDOTPTRDOTMETHDOTINTERXDOTDOTTYPEDOTTYPE2EQNELTLEGEGTDEREFINDEXINDEXMAPKEYSTRUCTKEYLENMAKEMAKECHANMAKEMAPMAKESLICEMAKESLICECOPYMULDIVMODLSHRSHANDANDNOTNEWNOTBITNOTPLUSNEGORORPANICPRINTPRINTNPARENSENDSLICESLICEARRSLICESTRSLICE3SLICE3ARRSLICEHEADERSTRINGHEADERRECOVERRECOVERFPRECVRUNESTRSELRECV2MINMAXREALIMAGCOMPLEXUNSAFEADDUNSAFESLICEUNSAFESLICEDATAUNSAFESTRINGUNSAFESTRINGDATAMETHEXPRMETHVALUEBLOCKBREAKCASECONTINUEDEFERFALLFORGOTOIFLABELGORANGERETURNSELECTSWITCHTYPESWINLCALLMAKEFACEITABIDATASPTRCFUNCCHECKNILRESULTINLMARKLINKSYMOFFSETJUMPTABLEDYNAMICDOTTYPEDYNAMICDOTTYPE2DYNAMICTYPETAILCALLGETGGETCALLERPCGETCALLERSPEND" const _Op_name = "XXXNAMENONAMETYPELITERALNILADDSUBORXORADDSTRADDRANDANDAPPENDBYTES2STRBYTES2STRTMPRUNES2STRSTR2BYTESSTR2BYTESTMPSTR2RUNESSLICE2ARRSLICE2ARRPTRASAS2AS2DOTTYPEAS2FUNCAS2MAPRAS2RECVASOPCALLCALLFUNCCALLMETHCALLINTERCAPCLEARCLOSECLOSURECOMPLITMAPLITSTRUCTLITARRAYLITSLICELITPTRLITCONVCONVIFACECONVNOPCOPYDCLDCLFUNCDELETEDOTDOTPTRDOTMETHDOTINTERXDOTDOTTYPEDOTTYPE2EQNELTLEGEGTDEREFINDEXINDEXMAPKEYSTRUCTKEYLENMAKEMAKECHANMAKEMAPMAKESLICEMAKESLICECOPYMULDIVMODLSHRSHANDANDNOTNEWNOTBITNOTPLUSNEGORORPANICPRINTPRINTNPARENSENDSLICESLICEARRSLICESTRSLICE3SLICE3ARRSLICEHEADERSTRINGHEADERRECOVERRECOVERFPRECVRUNESTRSELRECV2MINMAXREALIMAGCOMPLEXUNSAFEADDUNSAFESLICEUNSAFESLICEDATAUNSAFESTRINGUNSAFESTRINGDATAMETHEXPRMETHVALUEBLOCKBREAKCASECONTINUEDEFERFALLFORGOTOIFLABELGORANGERETURNSELECTSWITCHTYPESWINLCALLMAKEFACEITABIDATASPTRCFUNCCHECKNILRESULTINLMARKLINKSYMOFFSETJUMPTABLEINTERFACESWITCHDYNAMICDOTTYPEDYNAMICDOTTYPE2DYNAMICTYPETAILCALLGETGGETCALLERPCGETCALLERSPEND"
var _Op_index = [...]uint16{0, 3, 7, 13, 17, 24, 27, 30, 33, 35, 38, 44, 48, 54, 60, 69, 81, 90, 99, 111, 120, 129, 141, 143, 146, 156, 163, 170, 177, 181, 185, 193, 201, 210, 213, 218, 223, 230, 237, 243, 252, 260, 268, 274, 278, 287, 294, 298, 301, 308, 314, 317, 323, 330, 338, 342, 349, 357, 359, 361, 363, 365, 367, 369, 374, 379, 387, 390, 399, 402, 406, 414, 421, 430, 443, 446, 449, 452, 455, 458, 461, 467, 470, 473, 479, 483, 486, 490, 495, 500, 506, 511, 515, 520, 528, 536, 542, 551, 562, 574, 581, 590, 594, 601, 609, 612, 615, 619, 623, 630, 639, 650, 665, 677, 693, 701, 710, 715, 720, 724, 732, 737, 741, 744, 748, 750, 755, 757, 762, 768, 774, 780, 786, 793, 801, 805, 810, 814, 819, 827, 833, 840, 853, 862, 876, 891, 902, 910, 914, 925, 936, 939} var _Op_index = [...]uint16{0, 3, 7, 13, 17, 24, 27, 30, 33, 35, 38, 44, 48, 54, 60, 69, 81, 90, 99, 111, 120, 129, 141, 143, 146, 156, 163, 170, 177, 181, 185, 193, 201, 210, 213, 218, 223, 230, 237, 243, 252, 260, 268, 274, 278, 287, 294, 298, 301, 308, 314, 317, 323, 330, 338, 342, 349, 357, 359, 361, 363, 365, 367, 369, 374, 379, 387, 390, 399, 402, 406, 414, 421, 430, 443, 446, 449, 452, 455, 458, 461, 467, 470, 473, 479, 483, 486, 490, 495, 500, 506, 511, 515, 520, 528, 536, 542, 551, 562, 574, 581, 590, 594, 601, 609, 612, 615, 619, 623, 630, 639, 650, 665, 677, 693, 701, 710, 715, 720, 724, 732, 737, 741, 744, 748, 750, 755, 757, 762, 768, 774, 780, 786, 793, 801, 805, 810, 814, 819, 827, 833, 840, 853, 862, 877, 891, 906, 917, 925, 929, 940, 951, 954}
func (i Op) String() string { func (i Op) String() string {
if i >= Op(len(_Op_index)-1) { if i >= Op(len(_Op_index)-1) {

View File

@ -7,6 +7,7 @@ package ir
import ( import (
"cmd/compile/internal/base" "cmd/compile/internal/base"
"cmd/compile/internal/types" "cmd/compile/internal/types"
"cmd/internal/obj"
"cmd/internal/src" "cmd/internal/src"
"go/constant" "go/constant"
) )
@ -309,6 +310,42 @@ func NewJumpTableStmt(pos src.XPos, idx Node) *JumpTableStmt {
return n return n
} }
// An InterfaceSwitchStmt is used to implement type switches.
// Its semantics are:
//
// if RuntimeType implements Descriptor.Cases[0] {
// Case, Itab = 0, itab<RuntimeType, Descriptor.Cases[0]>
// } else if RuntimeType implements Descriptor.Cases[1] {
// Case, Itab = 1, itab<RuntimeType, Descriptor.Cases[1]>
// ...
// } else if RuntimeType implements Descriptor.Cases[N-1] {
// Case, Itab = N-1, itab<RuntimeType, Descriptor.Cases[N-1]>
// } else {
// Case, Itab = len(cases), nil
// }
// RuntimeType must be a non-nil *runtime._type.
// Descriptor must represent an abi.InterfaceSwitch global variable.
type InterfaceSwitchStmt struct {
miniStmt
Case Node
Itab Node
RuntimeType Node
Descriptor *obj.LSym
}
func NewInterfaceSwitchStmt(pos src.XPos, case_, itab, runtimeType Node, descriptor *obj.LSym) *InterfaceSwitchStmt {
n := &InterfaceSwitchStmt{
Case: case_,
Itab: itab,
RuntimeType: runtimeType,
Descriptor: descriptor,
}
n.pos = pos
n.op = OINTERFACESWITCH
return n
}
// An InlineMarkStmt is a marker placed just before an inlined body. // An InlineMarkStmt is a marker placed just before an inlined body.
type InlineMarkStmt struct { type InlineMarkStmt struct {
miniStmt miniStmt

View File

@ -31,6 +31,7 @@ type symsStruct struct {
GCWriteBarrier [8]*obj.LSym GCWriteBarrier [8]*obj.LSym
Goschedguarded *obj.LSym Goschedguarded *obj.LSym
Growslice *obj.LSym Growslice *obj.LSym
InterfaceSwitch *obj.LSym
Memmove *obj.LSym Memmove *obj.LSym
Msanread *obj.LSym Msanread *obj.LSym
Msanwrite *obj.LSym Msanwrite *obj.LSym

View File

@ -118,6 +118,7 @@ func InitConfig() {
ir.Syms.GCWriteBarrier[7] = typecheck.LookupRuntimeFunc("gcWriteBarrier8") ir.Syms.GCWriteBarrier[7] = typecheck.LookupRuntimeFunc("gcWriteBarrier8")
ir.Syms.Goschedguarded = typecheck.LookupRuntimeFunc("goschedguarded") ir.Syms.Goschedguarded = typecheck.LookupRuntimeFunc("goschedguarded")
ir.Syms.Growslice = typecheck.LookupRuntimeFunc("growslice") ir.Syms.Growslice = typecheck.LookupRuntimeFunc("growslice")
ir.Syms.InterfaceSwitch = typecheck.LookupRuntimeFunc("interfaceSwitch")
ir.Syms.Memmove = typecheck.LookupRuntimeFunc("memmove") ir.Syms.Memmove = typecheck.LookupRuntimeFunc("memmove")
ir.Syms.Msanread = typecheck.LookupRuntimeFunc("msanread") ir.Syms.Msanread = typecheck.LookupRuntimeFunc("msanread")
ir.Syms.Msanwrite = typecheck.LookupRuntimeFunc("msanwrite") ir.Syms.Msanwrite = typecheck.LookupRuntimeFunc("msanwrite")
@ -2017,6 +2018,15 @@ func (s *state) stmt(n ir.Node) {
s.startBlock(bEnd) s.startBlock(bEnd)
case ir.OINTERFACESWITCH:
n := n.(*ir.InterfaceSwitchStmt)
t := s.expr(n.RuntimeType)
d := s.newValue1A(ssa.OpAddr, s.f.Config.Types.BytePtr, n.Descriptor, s.sb)
r := s.rtcall(ir.Syms.InterfaceSwitch, true, []*types.Type{s.f.Config.Types.Int, s.f.Config.Types.BytePtr}, d, t)
s.assign(n.Case, r[0], false, 0)
s.assign(n.Itab, r[1], false, 0)
case ir.OCHECKNIL: case ir.OCHECKNIL:
n := n.(*ir.UnaryExpr) n := n.(*ir.UnaryExpr)
p := s.expr(n.X) p := s.expr(n.X)

View File

@ -160,6 +160,123 @@ func benchmarkSwitchType(b *testing.B, predictable bool) {
n += 8 n += 8
} }
} }
sink = n
}
func BenchmarkSwitchInterfaceTypePredictable(b *testing.B) {
benchmarkSwitchInterfaceType(b, true)
}
func BenchmarkSwitchInterfaceTypeUnpredictable(b *testing.B) {
benchmarkSwitchInterfaceType(b, false)
}
type SI0 interface {
si0()
}
type ST0 struct {
}
func (ST0) si0() {
}
type SI1 interface {
si1()
}
type ST1 struct {
}
func (ST1) si1() {
}
type SI2 interface {
si2()
}
type ST2 struct {
}
func (ST2) si2() {
}
type SI3 interface {
si3()
}
type ST3 struct {
}
func (ST3) si3() {
}
type SI4 interface {
si4()
}
type ST4 struct {
}
func (ST4) si4() {
}
type SI5 interface {
si5()
}
type ST5 struct {
}
func (ST5) si5() {
}
type SI6 interface {
si6()
}
type ST6 struct {
}
func (ST6) si6() {
}
type SI7 interface {
si7()
}
type ST7 struct {
}
func (ST7) si7() {
}
func benchmarkSwitchInterfaceType(b *testing.B, predictable bool) {
a := []any{
ST0{},
ST1{},
ST2{},
ST3{},
ST4{},
ST5{},
ST6{},
ST7{},
}
n := 0
rng := newRNG()
for i := 0; i < b.N; i++ {
rng = rng.next(predictable)
switch a[rng.value()&7].(type) {
case SI0:
n += 1
case SI1:
n += 2
case SI2:
n += 3
case SI3:
n += 4
case SI4:
n += 5
case SI5:
n += 6
case SI6:
n += 7
case SI7:
n += 8
}
}
sink = n
} }
// A simple random number generator used to make switches conditionally predictable. // A simple random number generator used to make switches conditionally predictable.

View File

@ -112,6 +112,9 @@ func panicdottypeE(have, want, iface *byte)
func panicdottypeI(have, want, iface *byte) func panicdottypeI(have, want, iface *byte)
func panicnildottype(want *byte) func panicnildottype(want *byte)
// interface switches
func interfaceSwitch(s *byte, t *byte) (int, *byte)
// interface equality. Type/itab pointers are already known to be equal, so // interface equality. Type/itab pointers are already known to be equal, so
// we only need to pass one. // we only need to pass one.
func ifaceeq(tab *uintptr, x, y unsafe.Pointer) (ret bool) func ifaceeq(tab *uintptr, x, y unsafe.Pointer) (ret bool)

View File

@ -101,141 +101,142 @@ var runtimeDecls = [...]struct {
{"panicdottypeE", funcTag, 71}, {"panicdottypeE", funcTag, 71},
{"panicdottypeI", funcTag, 71}, {"panicdottypeI", funcTag, 71},
{"panicnildottype", funcTag, 72}, {"panicnildottype", funcTag, 72},
{"ifaceeq", funcTag, 73}, {"interfaceSwitch", funcTag, 73},
{"efaceeq", funcTag, 73}, {"ifaceeq", funcTag, 74},
{"deferrangefunc", funcTag, 74}, {"efaceeq", funcTag, 74},
{"fastrand", funcTag, 75}, {"deferrangefunc", funcTag, 75},
{"makemap64", funcTag, 77}, {"fastrand", funcTag, 76},
{"makemap", funcTag, 78}, {"makemap64", funcTag, 78},
{"makemap_small", funcTag, 79}, {"makemap", funcTag, 79},
{"mapaccess1", funcTag, 80}, {"makemap_small", funcTag, 80},
{"mapaccess1_fast32", funcTag, 81}, {"mapaccess1", funcTag, 81},
{"mapaccess1_fast64", funcTag, 82}, {"mapaccess1_fast32", funcTag, 82},
{"mapaccess1_faststr", funcTag, 83}, {"mapaccess1_fast64", funcTag, 83},
{"mapaccess1_fat", funcTag, 84}, {"mapaccess1_faststr", funcTag, 84},
{"mapaccess2", funcTag, 85}, {"mapaccess1_fat", funcTag, 85},
{"mapaccess2_fast32", funcTag, 86}, {"mapaccess2", funcTag, 86},
{"mapaccess2_fast64", funcTag, 87}, {"mapaccess2_fast32", funcTag, 87},
{"mapaccess2_faststr", funcTag, 88}, {"mapaccess2_fast64", funcTag, 88},
{"mapaccess2_fat", funcTag, 89}, {"mapaccess2_faststr", funcTag, 89},
{"mapassign", funcTag, 80}, {"mapaccess2_fat", funcTag, 90},
{"mapassign_fast32", funcTag, 81}, {"mapassign", funcTag, 81},
{"mapassign_fast32ptr", funcTag, 90}, {"mapassign_fast32", funcTag, 82},
{"mapassign_fast64", funcTag, 82}, {"mapassign_fast32ptr", funcTag, 91},
{"mapassign_fast64ptr", funcTag, 90}, {"mapassign_fast64", funcTag, 83},
{"mapassign_faststr", funcTag, 83}, {"mapassign_fast64ptr", funcTag, 91},
{"mapiterinit", funcTag, 91}, {"mapassign_faststr", funcTag, 84},
{"mapdelete", funcTag, 91}, {"mapiterinit", funcTag, 92},
{"mapdelete_fast32", funcTag, 92}, {"mapdelete", funcTag, 92},
{"mapdelete_fast64", funcTag, 93}, {"mapdelete_fast32", funcTag, 93},
{"mapdelete_faststr", funcTag, 94}, {"mapdelete_fast64", funcTag, 94},
{"mapiternext", funcTag, 95}, {"mapdelete_faststr", funcTag, 95},
{"mapclear", funcTag, 96}, {"mapiternext", funcTag, 96},
{"makechan64", funcTag, 98}, {"mapclear", funcTag, 97},
{"makechan", funcTag, 99}, {"makechan64", funcTag, 99},
{"chanrecv1", funcTag, 101}, {"makechan", funcTag, 100},
{"chanrecv2", funcTag, 102}, {"chanrecv1", funcTag, 102},
{"chansend1", funcTag, 104}, {"chanrecv2", funcTag, 103},
{"chansend1", funcTag, 105},
{"closechan", funcTag, 30}, {"closechan", funcTag, 30},
{"writeBarrier", varTag, 106}, {"writeBarrier", varTag, 107},
{"typedmemmove", funcTag, 107}, {"typedmemmove", funcTag, 108},
{"typedmemclr", funcTag, 108}, {"typedmemclr", funcTag, 109},
{"typedslicecopy", funcTag, 109}, {"typedslicecopy", funcTag, 110},
{"selectnbsend", funcTag, 110}, {"selectnbsend", funcTag, 111},
{"selectnbrecv", funcTag, 111}, {"selectnbrecv", funcTag, 112},
{"selectsetpc", funcTag, 112}, {"selectsetpc", funcTag, 113},
{"selectgo", funcTag, 113}, {"selectgo", funcTag, 114},
{"block", funcTag, 9}, {"block", funcTag, 9},
{"makeslice", funcTag, 114}, {"makeslice", funcTag, 115},
{"makeslice64", funcTag, 115}, {"makeslice64", funcTag, 116},
{"makeslicecopy", funcTag, 116}, {"makeslicecopy", funcTag, 117},
{"growslice", funcTag, 118}, {"growslice", funcTag, 119},
{"unsafeslicecheckptr", funcTag, 119}, {"unsafeslicecheckptr", funcTag, 120},
{"panicunsafeslicelen", funcTag, 9}, {"panicunsafeslicelen", funcTag, 9},
{"panicunsafeslicenilptr", funcTag, 9}, {"panicunsafeslicenilptr", funcTag, 9},
{"unsafestringcheckptr", funcTag, 120}, {"unsafestringcheckptr", funcTag, 121},
{"panicunsafestringlen", funcTag, 9}, {"panicunsafestringlen", funcTag, 9},
{"panicunsafestringnilptr", funcTag, 9}, {"panicunsafestringnilptr", funcTag, 9},
{"memmove", funcTag, 121}, {"memmove", funcTag, 122},
{"memclrNoHeapPointers", funcTag, 122}, {"memclrNoHeapPointers", funcTag, 123},
{"memclrHasPointers", funcTag, 122}, {"memclrHasPointers", funcTag, 123},
{"memequal", funcTag, 123}, {"memequal", funcTag, 124},
{"memequal0", funcTag, 124}, {"memequal0", funcTag, 125},
{"memequal8", funcTag, 124}, {"memequal8", funcTag, 125},
{"memequal16", funcTag, 124}, {"memequal16", funcTag, 125},
{"memequal32", funcTag, 124}, {"memequal32", funcTag, 125},
{"memequal64", funcTag, 124}, {"memequal64", funcTag, 125},
{"memequal128", funcTag, 124}, {"memequal128", funcTag, 125},
{"f32equal", funcTag, 125}, {"f32equal", funcTag, 126},
{"f64equal", funcTag, 125}, {"f64equal", funcTag, 126},
{"c64equal", funcTag, 125}, {"c64equal", funcTag, 126},
{"c128equal", funcTag, 125}, {"c128equal", funcTag, 126},
{"strequal", funcTag, 125}, {"strequal", funcTag, 126},
{"interequal", funcTag, 125}, {"interequal", funcTag, 126},
{"nilinterequal", funcTag, 125}, {"nilinterequal", funcTag, 126},
{"memhash", funcTag, 126}, {"memhash", funcTag, 127},
{"memhash0", funcTag, 127}, {"memhash0", funcTag, 128},
{"memhash8", funcTag, 127}, {"memhash8", funcTag, 128},
{"memhash16", funcTag, 127}, {"memhash16", funcTag, 128},
{"memhash32", funcTag, 127}, {"memhash32", funcTag, 128},
{"memhash64", funcTag, 127}, {"memhash64", funcTag, 128},
{"memhash128", funcTag, 127}, {"memhash128", funcTag, 128},
{"f32hash", funcTag, 128}, {"f32hash", funcTag, 129},
{"f64hash", funcTag, 128}, {"f64hash", funcTag, 129},
{"c64hash", funcTag, 128}, {"c64hash", funcTag, 129},
{"c128hash", funcTag, 128}, {"c128hash", funcTag, 129},
{"strhash", funcTag, 128}, {"strhash", funcTag, 129},
{"interhash", funcTag, 128}, {"interhash", funcTag, 129},
{"nilinterhash", funcTag, 128}, {"nilinterhash", funcTag, 129},
{"int64div", funcTag, 129}, {"int64div", funcTag, 130},
{"uint64div", funcTag, 130}, {"uint64div", funcTag, 131},
{"int64mod", funcTag, 129}, {"int64mod", funcTag, 130},
{"uint64mod", funcTag, 130}, {"uint64mod", funcTag, 131},
{"float64toint64", funcTag, 131}, {"float64toint64", funcTag, 132},
{"float64touint64", funcTag, 132}, {"float64touint64", funcTag, 133},
{"float64touint32", funcTag, 133}, {"float64touint32", funcTag, 134},
{"int64tofloat64", funcTag, 134}, {"int64tofloat64", funcTag, 135},
{"int64tofloat32", funcTag, 136}, {"int64tofloat32", funcTag, 137},
{"uint64tofloat64", funcTag, 137}, {"uint64tofloat64", funcTag, 138},
{"uint64tofloat32", funcTag, 138}, {"uint64tofloat32", funcTag, 139},
{"uint32tofloat64", funcTag, 139}, {"uint32tofloat64", funcTag, 140},
{"complex128div", funcTag, 140}, {"complex128div", funcTag, 141},
{"getcallerpc", funcTag, 141}, {"getcallerpc", funcTag, 142},
{"getcallersp", funcTag, 141}, {"getcallersp", funcTag, 142},
{"racefuncenter", funcTag, 31}, {"racefuncenter", funcTag, 31},
{"racefuncexit", funcTag, 9}, {"racefuncexit", funcTag, 9},
{"raceread", funcTag, 31}, {"raceread", funcTag, 31},
{"racewrite", funcTag, 31}, {"racewrite", funcTag, 31},
{"racereadrange", funcTag, 142}, {"racereadrange", funcTag, 143},
{"racewriterange", funcTag, 142}, {"racewriterange", funcTag, 143},
{"msanread", funcTag, 142}, {"msanread", funcTag, 143},
{"msanwrite", funcTag, 142}, {"msanwrite", funcTag, 143},
{"msanmove", funcTag, 143}, {"msanmove", funcTag, 144},
{"asanread", funcTag, 142}, {"asanread", funcTag, 143},
{"asanwrite", funcTag, 142}, {"asanwrite", funcTag, 143},
{"checkptrAlignment", funcTag, 144}, {"checkptrAlignment", funcTag, 145},
{"checkptrArithmetic", funcTag, 146}, {"checkptrArithmetic", funcTag, 147},
{"libfuzzerTraceCmp1", funcTag, 147}, {"libfuzzerTraceCmp1", funcTag, 148},
{"libfuzzerTraceCmp2", funcTag, 148}, {"libfuzzerTraceCmp2", funcTag, 149},
{"libfuzzerTraceCmp4", funcTag, 149}, {"libfuzzerTraceCmp4", funcTag, 150},
{"libfuzzerTraceCmp8", funcTag, 150}, {"libfuzzerTraceCmp8", funcTag, 151},
{"libfuzzerTraceConstCmp1", funcTag, 147}, {"libfuzzerTraceConstCmp1", funcTag, 148},
{"libfuzzerTraceConstCmp2", funcTag, 148}, {"libfuzzerTraceConstCmp2", funcTag, 149},
{"libfuzzerTraceConstCmp4", funcTag, 149}, {"libfuzzerTraceConstCmp4", funcTag, 150},
{"libfuzzerTraceConstCmp8", funcTag, 150}, {"libfuzzerTraceConstCmp8", funcTag, 151},
{"libfuzzerHookStrCmp", funcTag, 151}, {"libfuzzerHookStrCmp", funcTag, 152},
{"libfuzzerHookEqualFold", funcTag, 151}, {"libfuzzerHookEqualFold", funcTag, 152},
{"addCovMeta", funcTag, 153}, {"addCovMeta", funcTag, 154},
{"x86HasPOPCNT", varTag, 6}, {"x86HasPOPCNT", varTag, 6},
{"x86HasSSE41", varTag, 6}, {"x86HasSSE41", varTag, 6},
{"x86HasFMA", varTag, 6}, {"x86HasFMA", varTag, 6},
{"armHasVFPv4", varTag, 6}, {"armHasVFPv4", varTag, 6},
{"arm64HasATOMICS", varTag, 6}, {"arm64HasATOMICS", varTag, 6},
{"asanregisterglobals", funcTag, 122}, {"asanregisterglobals", funcTag, 123},
} }
func runtimeTypes() []*types.Type { func runtimeTypes() []*types.Type {
var typs [154]*types.Type var typs [155]*types.Type
typs[0] = types.ByteType typs[0] = types.ByteType
typs[1] = types.NewPtr(typs[0]) typs[1] = types.NewPtr(typs[0])
typs[2] = types.Types[types.TANY] typs[2] = types.Types[types.TANY]
@ -309,87 +310,88 @@ func runtimeTypes() []*types.Type {
typs[70] = newSig(params(typs[1], typs[2]), params(typs[2])) typs[70] = newSig(params(typs[1], typs[2]), params(typs[2]))
typs[71] = newSig(params(typs[1], typs[1], typs[1]), nil) typs[71] = newSig(params(typs[1], typs[1], typs[1]), nil)
typs[72] = newSig(params(typs[1]), nil) typs[72] = newSig(params(typs[1]), nil)
typs[73] = newSig(params(typs[57], typs[7], typs[7]), params(typs[6])) typs[73] = newSig(params(typs[1], typs[1]), params(typs[15], typs[1]))
typs[74] = newSig(nil, params(typs[10])) typs[74] = newSig(params(typs[57], typs[7], typs[7]), params(typs[6]))
typs[75] = newSig(nil, params(typs[62])) typs[75] = newSig(nil, params(typs[10]))
typs[76] = types.NewMap(typs[2], typs[2]) typs[76] = newSig(nil, params(typs[62]))
typs[77] = newSig(params(typs[1], typs[22], typs[3]), params(typs[76])) typs[77] = types.NewMap(typs[2], typs[2])
typs[78] = newSig(params(typs[1], typs[15], typs[3]), params(typs[76])) typs[78] = newSig(params(typs[1], typs[22], typs[3]), params(typs[77]))
typs[79] = newSig(nil, params(typs[76])) typs[79] = newSig(params(typs[1], typs[15], typs[3]), params(typs[77]))
typs[80] = newSig(params(typs[1], typs[76], typs[3]), params(typs[3])) typs[80] = newSig(nil, params(typs[77]))
typs[81] = newSig(params(typs[1], typs[76], typs[62]), params(typs[3])) typs[81] = newSig(params(typs[1], typs[77], typs[3]), params(typs[3]))
typs[82] = newSig(params(typs[1], typs[76], typs[24]), params(typs[3])) typs[82] = newSig(params(typs[1], typs[77], typs[62]), params(typs[3]))
typs[83] = newSig(params(typs[1], typs[76], typs[28]), params(typs[3])) typs[83] = newSig(params(typs[1], typs[77], typs[24]), params(typs[3]))
typs[84] = newSig(params(typs[1], typs[76], typs[3], typs[1]), params(typs[3])) typs[84] = newSig(params(typs[1], typs[77], typs[28]), params(typs[3]))
typs[85] = newSig(params(typs[1], typs[76], typs[3]), params(typs[3], typs[6])) typs[85] = newSig(params(typs[1], typs[77], typs[3], typs[1]), params(typs[3]))
typs[86] = newSig(params(typs[1], typs[76], typs[62]), params(typs[3], typs[6])) typs[86] = newSig(params(typs[1], typs[77], typs[3]), params(typs[3], typs[6]))
typs[87] = newSig(params(typs[1], typs[76], typs[24]), params(typs[3], typs[6])) typs[87] = newSig(params(typs[1], typs[77], typs[62]), params(typs[3], typs[6]))
typs[88] = newSig(params(typs[1], typs[76], typs[28]), params(typs[3], typs[6])) typs[88] = newSig(params(typs[1], typs[77], typs[24]), params(typs[3], typs[6]))
typs[89] = newSig(params(typs[1], typs[76], typs[3], typs[1]), params(typs[3], typs[6])) typs[89] = newSig(params(typs[1], typs[77], typs[28]), params(typs[3], typs[6]))
typs[90] = newSig(params(typs[1], typs[76], typs[7]), params(typs[3])) typs[90] = newSig(params(typs[1], typs[77], typs[3], typs[1]), params(typs[3], typs[6]))
typs[91] = newSig(params(typs[1], typs[76], typs[3]), nil) typs[91] = newSig(params(typs[1], typs[77], typs[7]), params(typs[3]))
typs[92] = newSig(params(typs[1], typs[76], typs[62]), nil) typs[92] = newSig(params(typs[1], typs[77], typs[3]), nil)
typs[93] = newSig(params(typs[1], typs[76], typs[24]), nil) typs[93] = newSig(params(typs[1], typs[77], typs[62]), nil)
typs[94] = newSig(params(typs[1], typs[76], typs[28]), nil) typs[94] = newSig(params(typs[1], typs[77], typs[24]), nil)
typs[95] = newSig(params(typs[3]), nil) typs[95] = newSig(params(typs[1], typs[77], typs[28]), nil)
typs[96] = newSig(params(typs[1], typs[76]), nil) typs[96] = newSig(params(typs[3]), nil)
typs[97] = types.NewChan(typs[2], types.Cboth) typs[97] = newSig(params(typs[1], typs[77]), nil)
typs[98] = newSig(params(typs[1], typs[22]), params(typs[97])) typs[98] = types.NewChan(typs[2], types.Cboth)
typs[99] = newSig(params(typs[1], typs[15]), params(typs[97])) typs[99] = newSig(params(typs[1], typs[22]), params(typs[98]))
typs[100] = types.NewChan(typs[2], types.Crecv) typs[100] = newSig(params(typs[1], typs[15]), params(typs[98]))
typs[101] = newSig(params(typs[100], typs[3]), nil) typs[101] = types.NewChan(typs[2], types.Crecv)
typs[102] = newSig(params(typs[100], typs[3]), params(typs[6])) typs[102] = newSig(params(typs[101], typs[3]), nil)
typs[103] = types.NewChan(typs[2], types.Csend) typs[103] = newSig(params(typs[101], typs[3]), params(typs[6]))
typs[104] = newSig(params(typs[103], typs[3]), nil) typs[104] = types.NewChan(typs[2], types.Csend)
typs[105] = types.NewArray(typs[0], 3) typs[105] = newSig(params(typs[104], typs[3]), nil)
typs[106] = types.NewStruct([]*types.Field{types.NewField(src.NoXPos, Lookup("enabled"), typs[6]), types.NewField(src.NoXPos, Lookup("pad"), typs[105]), types.NewField(src.NoXPos, Lookup("needed"), typs[6]), types.NewField(src.NoXPos, Lookup("cgo"), typs[6]), types.NewField(src.NoXPos, Lookup("alignme"), typs[24])}) typs[106] = types.NewArray(typs[0], 3)
typs[107] = newSig(params(typs[1], typs[3], typs[3]), nil) typs[107] = types.NewStruct([]*types.Field{types.NewField(src.NoXPos, Lookup("enabled"), typs[6]), types.NewField(src.NoXPos, Lookup("pad"), typs[106]), types.NewField(src.NoXPos, Lookup("needed"), typs[6]), types.NewField(src.NoXPos, Lookup("cgo"), typs[6]), types.NewField(src.NoXPos, Lookup("alignme"), typs[24])})
typs[108] = newSig(params(typs[1], typs[3]), nil) typs[108] = newSig(params(typs[1], typs[3], typs[3]), nil)
typs[109] = newSig(params(typs[1], typs[3], typs[15], typs[3], typs[15]), params(typs[15])) typs[109] = newSig(params(typs[1], typs[3]), nil)
typs[110] = newSig(params(typs[103], typs[3]), params(typs[6])) typs[110] = newSig(params(typs[1], typs[3], typs[15], typs[3], typs[15]), params(typs[15]))
typs[111] = newSig(params(typs[3], typs[100]), params(typs[6], typs[6])) typs[111] = newSig(params(typs[104], typs[3]), params(typs[6]))
typs[112] = newSig(params(typs[57]), nil) typs[112] = newSig(params(typs[3], typs[101]), params(typs[6], typs[6]))
typs[113] = newSig(params(typs[1], typs[1], typs[57], typs[15], typs[15], typs[6]), params(typs[15], typs[6])) typs[113] = newSig(params(typs[57]), nil)
typs[114] = newSig(params(typs[1], typs[15], typs[15]), params(typs[7])) typs[114] = newSig(params(typs[1], typs[1], typs[57], typs[15], typs[15], typs[6]), params(typs[15], typs[6]))
typs[115] = newSig(params(typs[1], typs[22], typs[22]), params(typs[7])) typs[115] = newSig(params(typs[1], typs[15], typs[15]), params(typs[7]))
typs[116] = newSig(params(typs[1], typs[15], typs[15], typs[7]), params(typs[7])) typs[116] = newSig(params(typs[1], typs[22], typs[22]), params(typs[7]))
typs[117] = types.NewSlice(typs[2]) typs[117] = newSig(params(typs[1], typs[15], typs[15], typs[7]), params(typs[7]))
typs[118] = newSig(params(typs[3], typs[15], typs[15], typs[15], typs[1]), params(typs[117])) typs[118] = types.NewSlice(typs[2])
typs[119] = newSig(params(typs[1], typs[7], typs[22]), nil) typs[119] = newSig(params(typs[3], typs[15], typs[15], typs[15], typs[1]), params(typs[118]))
typs[120] = newSig(params(typs[7], typs[22]), nil) typs[120] = newSig(params(typs[1], typs[7], typs[22]), nil)
typs[121] = newSig(params(typs[3], typs[3], typs[5]), nil) typs[121] = newSig(params(typs[7], typs[22]), nil)
typs[122] = newSig(params(typs[7], typs[5]), nil) typs[122] = newSig(params(typs[3], typs[3], typs[5]), nil)
typs[123] = newSig(params(typs[3], typs[3], typs[5]), params(typs[6])) typs[123] = newSig(params(typs[7], typs[5]), nil)
typs[124] = newSig(params(typs[3], typs[3]), params(typs[6])) typs[124] = newSig(params(typs[3], typs[3], typs[5]), params(typs[6]))
typs[125] = newSig(params(typs[7], typs[7]), params(typs[6])) typs[125] = newSig(params(typs[3], typs[3]), params(typs[6]))
typs[126] = newSig(params(typs[3], typs[5], typs[5]), params(typs[5])) typs[126] = newSig(params(typs[7], typs[7]), params(typs[6]))
typs[127] = newSig(params(typs[7], typs[5]), params(typs[5])) typs[127] = newSig(params(typs[3], typs[5], typs[5]), params(typs[5]))
typs[128] = newSig(params(typs[3], typs[5]), params(typs[5])) typs[128] = newSig(params(typs[7], typs[5]), params(typs[5]))
typs[129] = newSig(params(typs[22], typs[22]), params(typs[22])) typs[129] = newSig(params(typs[3], typs[5]), params(typs[5]))
typs[130] = newSig(params(typs[24], typs[24]), params(typs[24])) typs[130] = newSig(params(typs[22], typs[22]), params(typs[22]))
typs[131] = newSig(params(typs[20]), params(typs[22])) typs[131] = newSig(params(typs[24], typs[24]), params(typs[24]))
typs[132] = newSig(params(typs[20]), params(typs[24])) typs[132] = newSig(params(typs[20]), params(typs[22]))
typs[133] = newSig(params(typs[20]), params(typs[62])) typs[133] = newSig(params(typs[20]), params(typs[24]))
typs[134] = newSig(params(typs[22]), params(typs[20])) typs[134] = newSig(params(typs[20]), params(typs[62]))
typs[135] = types.Types[types.TFLOAT32] typs[135] = newSig(params(typs[22]), params(typs[20]))
typs[136] = newSig(params(typs[22]), params(typs[135])) typs[136] = types.Types[types.TFLOAT32]
typs[137] = newSig(params(typs[24]), params(typs[20])) typs[137] = newSig(params(typs[22]), params(typs[136]))
typs[138] = newSig(params(typs[24]), params(typs[135])) typs[138] = newSig(params(typs[24]), params(typs[20]))
typs[139] = newSig(params(typs[62]), params(typs[20])) typs[139] = newSig(params(typs[24]), params(typs[136]))
typs[140] = newSig(params(typs[26], typs[26]), params(typs[26])) typs[140] = newSig(params(typs[62]), params(typs[20]))
typs[141] = newSig(nil, params(typs[5])) typs[141] = newSig(params(typs[26], typs[26]), params(typs[26]))
typs[142] = newSig(params(typs[5], typs[5]), nil) typs[142] = newSig(nil, params(typs[5]))
typs[143] = newSig(params(typs[5], typs[5], typs[5]), nil) typs[143] = newSig(params(typs[5], typs[5]), nil)
typs[144] = newSig(params(typs[7], typs[1], typs[5]), nil) typs[144] = newSig(params(typs[5], typs[5], typs[5]), nil)
typs[145] = types.NewSlice(typs[7]) typs[145] = newSig(params(typs[7], typs[1], typs[5]), nil)
typs[146] = newSig(params(typs[7], typs[145]), nil) typs[146] = types.NewSlice(typs[7])
typs[147] = newSig(params(typs[66], typs[66], typs[17]), nil) typs[147] = newSig(params(typs[7], typs[146]), nil)
typs[148] = newSig(params(typs[60], typs[60], typs[17]), nil) typs[148] = newSig(params(typs[66], typs[66], typs[17]), nil)
typs[149] = newSig(params(typs[62], typs[62], typs[17]), nil) typs[149] = newSig(params(typs[60], typs[60], typs[17]), nil)
typs[150] = newSig(params(typs[24], typs[24], typs[17]), nil) typs[150] = newSig(params(typs[62], typs[62], typs[17]), nil)
typs[151] = newSig(params(typs[28], typs[28], typs[17]), nil) typs[151] = newSig(params(typs[24], typs[24], typs[17]), nil)
typs[152] = types.NewArray(typs[0], 16) typs[152] = newSig(params(typs[28], typs[28], typs[17]), nil)
typs[153] = newSig(params(typs[7], typs[62], typs[152], typs[28], typs[15], typs[66], typs[66]), params(typs[62])) typs[153] = types.NewArray(typs[0], 16)
typs[154] = newSig(params(typs[7], typs[62], typs[153], typs[28], typs[15], typs[66], typs[66]), params(typs[62]))
return typs[:] return typs[:]
} }

View File

@ -88,6 +88,7 @@ func walkStmt(n ir.Node) ir.Node {
ir.OGOTO, ir.OGOTO,
ir.OLABEL, ir.OLABEL,
ir.OJUMPTABLE, ir.OJUMPTABLE,
ir.OINTERFACESWITCH,
ir.ODCL, ir.ODCL,
ir.OCHECKNIL: ir.OCHECKNIL:
return n return n

View File

@ -5,6 +5,7 @@
package walk package walk
import ( import (
"fmt"
"go/constant" "go/constant"
"go/token" "go/token"
"math/bits" "math/bits"
@ -12,9 +13,12 @@ import (
"cmd/compile/internal/base" "cmd/compile/internal/base"
"cmd/compile/internal/ir" "cmd/compile/internal/ir"
"cmd/compile/internal/objw"
"cmd/compile/internal/reflectdata"
"cmd/compile/internal/ssagen" "cmd/compile/internal/ssagen"
"cmd/compile/internal/typecheck" "cmd/compile/internal/typecheck"
"cmd/compile/internal/types" "cmd/compile/internal/types"
"cmd/internal/obj"
"cmd/internal/src" "cmd/internal/src"
) )
@ -379,17 +383,19 @@ func endsInFallthrough(stmts []ir.Node) (bool, src.XPos) {
// type switch. // type switch.
func walkSwitchType(sw *ir.SwitchStmt) { func walkSwitchType(sw *ir.SwitchStmt) {
var s typeSwitch var s typeSwitch
s.facename = sw.Tag.(*ir.TypeSwitchGuard).X s.srcName = sw.Tag.(*ir.TypeSwitchGuard).X
sw.Tag = nil s.srcName = walkExpr(s.srcName, sw.PtrInit())
s.srcName = copyExpr(s.srcName, s.srcName.Type(), &sw.Compiled)
s.facename = walkExpr(s.facename, sw.PtrInit()) s.okName = typecheck.TempAt(base.Pos, ir.CurFunc, types.Types[types.TBOOL])
s.facename = copyExpr(s.facename, s.facename.Type(), &sw.Compiled) s.itabName = typecheck.TempAt(base.Pos, ir.CurFunc, types.Types[types.TUINT8].PtrTo())
s.okname = typecheck.TempAt(base.Pos, ir.CurFunc, types.Types[types.TBOOL])
// Get interface descriptor word. // Get interface descriptor word.
// For empty interfaces this will be the type. // For empty interfaces this will be the type.
// For non-empty interfaces this will be the itab. // For non-empty interfaces this will be the itab.
itab := ir.NewUnaryExpr(base.Pos, ir.OITAB, s.facename) srcItab := ir.NewUnaryExpr(base.Pos, ir.OITAB, s.srcName)
srcData := ir.NewUnaryExpr(base.Pos, ir.OIDATA, s.srcName)
srcData.SetType(types.Types[types.TUINT8].PtrTo())
srcData.SetTypecheck(1)
// For empty interfaces, do: // For empty interfaces, do:
// if e._type == nil { // if e._type == nil {
@ -398,42 +404,49 @@ func walkSwitchType(sw *ir.SwitchStmt) {
// h := e._type.hash // h := e._type.hash
// Use a similar strategy for non-empty interfaces. // Use a similar strategy for non-empty interfaces.
ifNil := ir.NewIfStmt(base.Pos, nil, nil, nil) ifNil := ir.NewIfStmt(base.Pos, nil, nil, nil)
ifNil.Cond = ir.NewBinaryExpr(base.Pos, ir.OEQ, itab, typecheck.NodNil()) ifNil.Cond = ir.NewBinaryExpr(base.Pos, ir.OEQ, srcItab, typecheck.NodNil())
base.Pos = base.Pos.WithNotStmt() // disable statement marks after the first check. base.Pos = base.Pos.WithNotStmt() // disable statement marks after the first check.
ifNil.Cond = typecheck.Expr(ifNil.Cond) ifNil.Cond = typecheck.Expr(ifNil.Cond)
ifNil.Cond = typecheck.DefaultLit(ifNil.Cond, nil) ifNil.Cond = typecheck.DefaultLit(ifNil.Cond, nil)
// ifNil.Nbody assigned at end. // ifNil.Nbody assigned later.
sw.Compiled.Append(ifNil) sw.Compiled.Append(ifNil)
// Load hash from type or itab. // Load hash from type or itab.
dotHash := typeHashFieldOf(base.Pos, itab) dotHash := typeHashFieldOf(base.Pos, srcItab)
s.hashname = copyExpr(dotHash, dotHash.Type(), &sw.Compiled) s.hashName = copyExpr(dotHash, dotHash.Type(), &sw.Compiled)
br := ir.NewBranchStmt(base.Pos, ir.OBREAK, nil) // Make a label for each case body.
var defaultGoto, nilGoto ir.Node labels := make([]*types.Sym, len(sw.Cases))
var body ir.Nodes for i := range sw.Cases {
for _, ncase := range sw.Cases { labels[i] = typecheck.AutoLabel(".s")
caseVar := ncase.Var
// For single-type cases with an interface type,
// we initialize the case variable as part of the type assertion.
// In other cases, we initialize it in the body.
var singleType *types.Type
if len(ncase.List) == 1 && ncase.List[0].Op() == ir.OTYPE {
singleType = ncase.List[0].Type()
} }
caseVarInitialized := false
label := typecheck.AutoLabel(".s") // "jump" to execute if no case matches.
jmp := ir.NewBranchStmt(ncase.Pos(), ir.OGOTO, label) br := ir.NewBranchStmt(base.Pos, ir.OBREAK, nil)
// Assemble a list of all the types we're looking for.
// This pass flattens the case lists, as well as handles
// some unusual cases, like default and nil cases.
type oneCase struct {
pos src.XPos
jmp ir.Node // jump to body of selected case
// The case we're matching. Normally the type we're looking for
// is typ.Type(), but when typ is ODYNAMICTYPE the actual type
// we're looking for is not a compile-time constant (typ.Type()
// will be its shape).
typ ir.Node
}
var cases []oneCase
var defaultGoto, nilGoto ir.Node
for i, ncase := range sw.Cases {
jmp := ir.NewBranchStmt(ncase.Pos(), ir.OGOTO, labels[i])
if len(ncase.List) == 0 { // default: if len(ncase.List) == 0 { // default:
if defaultGoto != nil { if defaultGoto != nil {
base.Fatalf("duplicate default case not detected during typechecking") base.Fatalf("duplicate default case not detected during typechecking")
} }
defaultGoto = jmp defaultGoto = jmp
} }
for _, n1 := range ncase.List { for _, n1 := range ncase.List {
if ir.IsNil(n1) { // case nil: if ir.IsNil(n1) { // case nil:
if nilGoto != nil { if nilGoto != nil {
@ -442,45 +455,30 @@ func walkSwitchType(sw *ir.SwitchStmt) {
nilGoto = jmp nilGoto = jmp
continue continue
} }
if n1.Op() == ir.ODYNAMICTYPE {
if singleType != nil && singleType.IsInterface() { // Convert dynamic to static, if the dynamic is actually static.
s.Add(ncase.Pos(), n1, caseVar, jmp) // TODO: why isn't this OTYPE to begin with?
caseVarInitialized = true dt := n1.(*ir.DynamicType)
} else { if dt.RType != nil && dt.RType.Op() == ir.OADDR {
s.Add(ncase.Pos(), n1, nil, jmp) addr := dt.RType.(*ir.AddrExpr)
if addr.X.Op() == ir.OLINKSYMOFFSET {
n1 = ir.TypeNode(n1.Type())
} }
} }
if dt.ITab != nil && dt.ITab.Op() == ir.OADDR {
body.Append(ir.NewLabelStmt(ncase.Pos(), label)) addr := dt.ITab.(*ir.AddrExpr)
if caseVar != nil && !caseVarInitialized { if addr.X.Op() == ir.OLINKSYMOFFSET {
val := s.facename n1 = ir.TypeNode(n1.Type())
if singleType != nil {
// We have a single concrete type. Extract the data.
if singleType.IsInterface() {
base.Fatalf("singleType interface should have been handled in Add")
} }
val = ifaceData(ncase.Pos(), s.facename, singleType)
} }
if len(ncase.List) == 1 && ncase.List[0].Op() == ir.ODYNAMICTYPE {
dt := ncase.List[0].(*ir.DynamicType)
x := ir.NewDynamicTypeAssertExpr(ncase.Pos(), ir.ODYNAMICDOTTYPE, val, dt.RType)
x.ITab = dt.ITab
x.SetType(caseVar.Type())
x.SetTypecheck(1)
val = x
} }
l := []ir.Node{ cases = append(cases, oneCase{
ir.NewDecl(ncase.Pos(), ir.ODCL, caseVar), pos: ncase.Pos(),
ir.NewAssignStmt(ncase.Pos(), caseVar, val), typ: n1,
jmp: jmp,
})
} }
typecheck.Stmts(l)
body.Append(l...)
} }
body.Append(ncase.Body...)
body.Append(br)
}
sw.Cases = nil
if defaultGoto == nil { if defaultGoto == nil {
defaultGoto = br defaultGoto = br
} }
@ -489,13 +487,196 @@ func walkSwitchType(sw *ir.SwitchStmt) {
} }
ifNil.Body = []ir.Node{nilGoto} ifNil.Body = []ir.Node{nilGoto}
s.Emit(&sw.Compiled) // Now go through the list of cases, processing groups as we find them.
sw.Compiled.Append(defaultGoto) var concreteCases []oneCase
sw.Compiled.Append(body.Take()...) var interfaceCases []oneCase
flush := func() {
// Process all the concrete types first. Because we handle shadowing
// below, it is correct to do all the concrete types before all of
// the interface types.
// The concrete cases can all be handled without a runtime call.
if len(concreteCases) > 0 {
var clauses []typeClause
for _, c := range concreteCases {
as := ir.NewAssignListStmt(c.pos, ir.OAS2,
[]ir.Node{ir.BlankNode, s.okName}, // _, ok =
[]ir.Node{ir.NewTypeAssertExpr(c.pos, s.srcName, c.typ.Type())}) // iface.(type)
nif := ir.NewIfStmt(c.pos, s.okName, []ir.Node{c.jmp}, nil)
clauses = append(clauses, typeClause{
hash: types.TypeHash(c.typ.Type()),
body: []ir.Node{typecheck.Stmt(as), typecheck.Stmt(nif)},
})
}
s.flush(clauses, &sw.Compiled)
concreteCases = concreteCases[:0]
}
// The "any" case, if it exists, must be the last interface case, because
// it would shadow all subsequent cases. Strip it off here so the runtime
// call only needs to handle non-empty interfaces.
var anyGoto ir.Node
if len(interfaceCases) > 0 && interfaceCases[len(interfaceCases)-1].typ.Type().IsEmptyInterface() {
anyGoto = interfaceCases[len(interfaceCases)-1].jmp
interfaceCases = interfaceCases[:len(interfaceCases)-1]
}
// Next, process all the interface types with a single call to the runtime.
if len(interfaceCases) > 0 {
// Build an internal/abi.InterfaceSwitch descriptor to pass to the runtime.
lsym := types.LocalPkg.Lookup(fmt.Sprintf(".interfaceSwitch.%d", interfaceSwitchGen)).LinksymABI(obj.ABI0)
interfaceSwitchGen++
off := 0
off = objw.Uintptr(lsym, off, uint64(len(interfaceCases)))
for _, c := range interfaceCases {
off = objw.SymPtr(lsym, off, reflectdata.TypeSym(c.typ.Type()).Linksym(), 0)
}
// Note: it has pointers, just not ones the GC cares about.
objw.Global(lsym, int32(off), obj.LOCAL|obj.NOPTR)
// Call runtime to do switch
// case, itab = runtime.interfaceSwitch(&descriptor, typeof(arg))
var typeArg ir.Node
if s.srcName.Type().IsEmptyInterface() {
typeArg = ir.NewConvExpr(base.Pos, ir.OCONVNOP, types.Types[types.TUINT8].PtrTo(), srcItab)
} else {
typeArg = itabType(srcItab)
}
caseVar := typecheck.TempAt(base.Pos, ir.CurFunc, types.Types[types.TINT])
isw := ir.NewInterfaceSwitchStmt(base.Pos, caseVar, s.itabName, typeArg, lsym)
sw.Compiled.Append(isw)
// Switch on the result of the call.
var newCases []*ir.CaseClause
for i, c := range interfaceCases {
newCases = append(newCases, &ir.CaseClause{
List: []ir.Node{ir.NewInt(base.Pos, int64(i))},
Body: []ir.Node{c.jmp},
})
}
// TODO: add len(newCases) case, mark switch as bounded
sw2 := ir.NewSwitchStmt(base.Pos, caseVar, newCases)
sw.Compiled.Append(typecheck.Stmt(sw2))
interfaceCases = interfaceCases[:0]
}
if anyGoto != nil {
// We've already handled the nil case, so everything
// that reaches here matches the "any" case.
sw.Compiled.Append(anyGoto)
}
}
caseLoop:
for _, c := range cases {
if c.typ.Op() == ir.ODYNAMICTYPE {
flush() // process all previous cases
dt := c.typ.(*ir.DynamicType)
dot := ir.NewDynamicTypeAssertExpr(c.pos, ir.ODYNAMICDOTTYPE, s.srcName, dt.RType)
dot.ITab = dt.ITab
dot.SetType(c.typ.Type())
dot.SetTypecheck(1)
as := ir.NewAssignListStmt(c.pos, ir.OAS2, nil, nil)
as.Lhs = []ir.Node{ir.BlankNode, s.okName} // _, ok =
as.Rhs = []ir.Node{dot}
typecheck.Stmt(as)
nif := ir.NewIfStmt(c.pos, s.okName, []ir.Node{c.jmp}, nil)
sw.Compiled.Append(as, nif)
continue
}
// Check for shadowing (a case that will never fire because
// a previous case would have always fired first). This check
// allows us to reorder concrete and interface cases.
// (TODO: these should be vet failures, maybe?)
for _, ic := range interfaceCases {
// An interface type case will shadow all
// subsequent types that implement that interface.
if typecheck.Implements(c.typ.Type(), ic.typ.Type()) {
continue caseLoop
}
// Note that we don't need to worry about:
// 1. Two concrete types shadowing each other. That's
// disallowed by the spec.
// 2. A concrete type shadowing an interface type.
// That can never happen, as interface types can
// be satisfied by an infinite set of concrete types.
// The correctness of this step also depends on handling
// the dynamic type cases separately, as we do above.
}
if c.typ.Type().IsInterface() {
interfaceCases = append(interfaceCases, c)
} else {
concreteCases = append(concreteCases, c)
}
}
flush()
sw.Compiled.Append(defaultGoto) // if none of the cases matched
// Now generate all the case bodies
for i, ncase := range sw.Cases {
sw.Compiled.Append(ir.NewLabelStmt(ncase.Pos(), labels[i]))
if caseVar := ncase.Var; caseVar != nil {
val := s.srcName
if len(ncase.List) == 1 {
// single type. We have to downcast the input value to the target type.
if ncase.List[0].Op() == ir.OTYPE { // single compile-time known type
t := ncase.List[0].Type()
if t.IsInterface() {
// This case is an interface. Build case value from input interface.
// The data word will always be the same, but the itab/type changes.
if t.IsEmptyInterface() {
var typ ir.Node
if s.srcName.Type().IsEmptyInterface() {
// E->E, nothing to do, type is already correct.
typ = srcItab
} else {
// I->E, load type out of itab
typ = itabType(srcItab)
typ.SetPos(ncase.Pos())
}
val = ir.NewBinaryExpr(ncase.Pos(), ir.OMAKEFACE, typ, srcData)
} else {
// The itab we need was returned by a runtime.interfaceSwitch call.
val = ir.NewBinaryExpr(ncase.Pos(), ir.OMAKEFACE, s.itabName, srcData)
}
} else {
// This case is a concrete type, just read its value out of the interface.
val = ifaceData(ncase.Pos(), s.srcName, t)
}
} else if ncase.List[0].Op() == ir.ODYNAMICTYPE { // single runtime known type
dt := ncase.List[0].(*ir.DynamicType)
x := ir.NewDynamicTypeAssertExpr(ncase.Pos(), ir.ODYNAMICDOTTYPE, val, dt.RType)
x.ITab = dt.ITab
val = x
} else if ir.IsNil(ncase.List[0]) {
} else {
base.Fatalf("unhandled type switch case %v", ncase.List[0])
}
val.SetType(caseVar.Type())
val.SetTypecheck(1)
}
l := []ir.Node{
ir.NewDecl(ncase.Pos(), ir.ODCL, caseVar),
ir.NewAssignStmt(ncase.Pos(), caseVar, val),
}
typecheck.Stmts(l)
sw.Compiled.Append(l...)
}
sw.Compiled.Append(ncase.Body...)
sw.Compiled.Append(br)
}
walkStmtList(sw.Compiled) walkStmtList(sw.Compiled)
sw.Tag = nil
sw.Cases = nil
} }
var interfaceSwitchGen int
// typeHashFieldOf returns an expression to select the type hash field // typeHashFieldOf returns an expression to select the type hash field
// from an interface's descriptor word (whether a *runtime._type or // from an interface's descriptor word (whether a *runtime._type or
// *runtime.itab pointer). // *runtime.itab pointer).
@ -525,12 +706,10 @@ var rtypeHashField, itabHashField *types.Field
// A typeSwitch walks a type switch. // A typeSwitch walks a type switch.
type typeSwitch struct { type typeSwitch struct {
// Temporary variables (i.e., ONAMEs) used by type switch dispatch logic: // Temporary variables (i.e., ONAMEs) used by type switch dispatch logic:
facename ir.Node // value being type-switched on srcName ir.Node // value being type-switched on
hashname ir.Node // type hash of the value being type-switched on hashName ir.Node // type hash of the value being type-switched on
okname ir.Node // boolean used for comma-ok type assertions okName ir.Node // boolean used for comma-ok type assertions
itabName ir.Node // itab value to use for first word of non-empty interface
done ir.Nodes
clauses []typeClause
} }
type typeClause struct { type typeClause struct {
@ -538,68 +717,7 @@ type typeClause struct {
body ir.Nodes body ir.Nodes
} }
func (s *typeSwitch) Add(pos src.XPos, n1 ir.Node, caseVar *ir.Name, jmp ir.Node) { func (s *typeSwitch) flush(cc []typeClause, compiled *ir.Nodes) {
typ := n1.Type()
var body ir.Nodes
if caseVar != nil {
l := []ir.Node{
ir.NewDecl(pos, ir.ODCL, caseVar),
ir.NewAssignStmt(pos, caseVar, nil),
}
typecheck.Stmts(l)
body.Append(l...)
} else {
caseVar = ir.BlankNode
}
// cv, ok = iface.(type)
as := ir.NewAssignListStmt(pos, ir.OAS2, nil, nil)
as.Lhs = []ir.Node{caseVar, s.okname} // cv, ok =
switch n1.Op() {
case ir.OTYPE:
// Static type assertion (non-generic)
dot := ir.NewTypeAssertExpr(pos, s.facename, typ) // iface.(type)
as.Rhs = []ir.Node{dot}
case ir.ODYNAMICTYPE:
// Dynamic type assertion (generic)
dt := n1.(*ir.DynamicType)
dot := ir.NewDynamicTypeAssertExpr(pos, ir.ODYNAMICDOTTYPE, s.facename, dt.RType)
dot.ITab = dt.ITab
dot.SetType(typ)
dot.SetTypecheck(1)
as.Rhs = []ir.Node{dot}
default:
base.Fatalf("unhandled type case %s", n1.Op())
}
appendWalkStmt(&body, as)
// if ok { goto label }
nif := ir.NewIfStmt(pos, nil, nil, nil)
nif.Cond = s.okname
nif.Body = []ir.Node{jmp}
body.Append(nif)
if n1.Op() == ir.OTYPE && !typ.IsInterface() {
// Defer static, noninterface cases so they can be binary searched by hash.
s.clauses = append(s.clauses, typeClause{
hash: types.TypeHash(n1.Type()),
body: body,
})
return
}
s.flush()
s.done.Append(body.Take()...)
}
func (s *typeSwitch) Emit(out *ir.Nodes) {
s.flush()
out.Append(s.done.Take()...)
}
func (s *typeSwitch) flush() {
cc := s.clauses
s.clauses = nil
if len(cc) == 0 { if len(cc) == 0 {
return return
} }
@ -618,18 +736,18 @@ func (s *typeSwitch) flush() {
} }
cc = merged cc = merged
if s.tryJumpTable(cc, &s.done) { if s.tryJumpTable(cc, compiled) {
return return
} }
binarySearch(len(cc), &s.done, binarySearch(len(cc), compiled,
func(i int) ir.Node { func(i int) ir.Node {
return ir.NewBinaryExpr(base.Pos, ir.OLE, s.hashname, ir.NewInt(base.Pos, int64(cc[i-1].hash))) return ir.NewBinaryExpr(base.Pos, ir.OLE, s.hashName, ir.NewInt(base.Pos, int64(cc[i-1].hash)))
}, },
func(i int, nif *ir.IfStmt) { func(i int, nif *ir.IfStmt) {
// TODO(mdempsky): Omit hash equality check if // TODO(mdempsky): Omit hash equality check if
// there's only one type. // there's only one type.
c := cc[i] c := cc[i]
nif.Cond = ir.NewBinaryExpr(base.Pos, ir.OEQ, s.hashname, ir.NewInt(base.Pos, int64(c.hash))) nif.Cond = ir.NewBinaryExpr(base.Pos, ir.OEQ, s.hashName, ir.NewInt(base.Pos, int64(c.hash)))
nif.Body.Append(c.body.Take()...) nif.Body.Append(c.body.Take()...)
}, },
) )
@ -670,7 +788,7 @@ func (s *typeSwitch) tryJumpTable(cc []typeClause, out *ir.Nodes) bool {
} }
// All hashes are distinct. Use these values of b and i. // All hashes are distinct. Use these values of b and i.
h := s.hashname h := s.hashName
if i != 0 { if i != 0 {
h = ir.NewBinaryExpr(base.Pos, ir.ORSH, h, ir.NewInt(base.Pos, int64(i))) h = ir.NewBinaryExpr(base.Pos, ir.ORSH, h, ir.NewInt(base.Pos, int64(i)))
} }

View File

@ -0,0 +1,13 @@
// Copyright 2023 The Go Authors. All rights reserved.
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
package abi
type InterfaceSwitch struct {
NCases int
// Array of NCases elements.
// Each case must be a non-empty interface type.
Cases [1]*InterfaceType
}

View File

@ -468,6 +468,22 @@ func assertE2I2(inter *interfacetype, e eface) (r iface) {
return return
} }
// interfaceSwitch compares t against the list of cases in s.
// If t matches case i, interfaceSwitch returns the case index i and
// an itab for the pair <t, s.Cases[i]>.
// If there is no match, return N,nil, where N is the number
// of cases.
func interfaceSwitch(s *abi.InterfaceSwitch, t *_type) (int, *itab) {
cases := unsafe.Slice(&s.Cases[0], s.NCases)
for i, c := range cases {
tab := getitab(c, t, true)
if tab != nil {
return i, tab
}
}
return len(cases), nil
}
//go:linkname reflect_ifaceE2I reflect.ifaceE2I //go:linkname reflect_ifaceE2I reflect.ifaceE2I
func reflect_ifaceE2I(inter *interfacetype, e eface, dst *iface) { func reflect_ifaceE2I(inter *interfacetype, e eface, dst *iface) {
*dst = iface{assertE2I(inter, e._type), e.data} *dst = iface{assertE2I(inter, e._type), e.data}

View File

@ -118,3 +118,24 @@ func typeSwitch(x any) int {
} }
return 7 return 7
} }
type I interface {
foo()
}
type J interface {
bar()
}
// use a runtime call for type switches to interface types.
func interfaceSwitch(x any) int {
// amd64:`CALL\truntime.interfaceSwitch`
// arm64:`CALL\truntime.interfaceSwitch`
switch x.(type) {
case I:
return 1
case J:
return 2
default:
return 3
}
}